PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01000001G0820
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GATA
Protein Properties Length: 254aa    MW: 27228.4 Da    PI: 7.5611
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01000001G0820genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA57.61.7e-18174207235
             GATA   2 snCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      s+Cg+ kTp+WR gp+g ktLCnaCG++y++ +l
  PH01000001G0820 174 SHCGVQKTPQWRAGPEGAKTLCNACGVRYKSGRL 207
                      69****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004014.9E-14167221IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-13174205IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011410.014174203IPR000679Zinc finger, GATA-type
PfamPF003201.9E-16174207IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.05E-11174230No hitNo description
CDDcd002028.46E-14175229No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MAEREGFSVE DLLDLEEFCE ADKDGAEEHE GEEAPPAAAD QEKSNDDSQQ SSVVSYELVP  60
PPPPPPEIVD LPAKRSKRSR ASGWSLSGAP PFSDSTSSSS TTTTSSCSSS ASFSPFFLLD  120
SPPLGVSDLP EDYHHLPPPA KKYKHKHKPK KRGRKPKQLP PHPFSAAAAS PAGSHCGVQK  180
TPQWRAGPEG AKTLCNACGV RYKSGRLLPE YRPACSPTFV GSIHSNSHRK VLEMRRKKDA  240
DLITTAAPAV ASF*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1143153KHKHKPKKRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9471366e-81EU947136.1 Zea mays clone 328769 mRNA sequence.
GenBankEU9554326e-81EU955432.1 Zea mays clone 1531924 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015692212.13e-68PREDICTED: GATA transcription factor 5-like
TrEMBLJ3LZZ43e-68J3LZZ4_ORYBR; Uncharacterized protein
STRINGOB04G27190.18e-68(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP141733108
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.21e-37GATA transcription factor 5